PDB entry 5xmv

View 5xmv on RCSB PDB site
Description: Plasmodium vivax SHMT bound with PLP-glycine and GS362
Class: transferase/transferase inhibitor
Keywords: alpha and beta protein, Transferase, methyltransferase activity, Inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-05-16, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xmva_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xmvb_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xmvc_
  • Heterogens: PLG, 8AU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmvA (A:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmvB (B:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmvC (C:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp