PDB entry 5xmr

View 5xmr on RCSB PDB site
Description: Plasmodium vivax SHMT(C346A) bound with PLP-glycine and GS395
Class: transferase/transferase inhibitor
Keywords: alpha and beta protein, methyltransferase activity, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-05-16, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1G4H5I1 (0-441)
      • engineered mutation (363)
    Domains in SCOPe 2.07: d5xmra_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1G4H5I1 (0-441)
      • engineered mutation (363)
    Domains in SCOPe 2.07: d5xmrb_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1G4H5I1 (0-441)
      • engineered mutation (363)
    Domains in SCOPe 2.07: d5xmrc_
  • Heterogens: PLG, 8AO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmrA (A:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdavspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmrB (B:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdavspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmrC (C:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdavspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp