PDB entry 5xmh

View 5xmh on RCSB PDB site
Description: Crystal structure of an IgM rheumatoid factor YES8c in complex with IgG1 Fc
Class: immune system
Keywords: Immunoglobulin, Complex, Rheumatoid factor, Autoantibody, IMMUNE SYSTEM
Deposited on 2017-05-15, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xmha1, d5xmha2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xmhb1, d5xmhb2
  • Chain 'C':
    Compound: YES8c light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XMH
    Domains in SCOPe 2.07: d5xmhc_
  • Chain 'D':
    Compound: YES8c heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XMH
  • Chain 'H':
    Compound: YES8c heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XMH
  • Chain 'L':
    Compound: YES8c light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XMH
    Domains in SCOPe 2.07: d5xmhl1, d5xmhl2
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmhA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xmhB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xmhB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xmhC (C:)
    meivltqspgtlslspgeratlscrasqsisssylawyqqrpgqaprlliygastratgi
    pdrfsgsgsgtdftltisrlepedfavyycqqygsspytfgqgtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xmhC (C:)
    eivltqspgtlslspgeratlscrasqsisssylawyqqrpgqaprlliygastratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspytfgqgtklei
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5xmhL (L:)
    meivltqspgtlslspgeratlscrasqsisssylawyqqrpgqaprlliygastratgi
    pdrfsgsgsgtdftltisrlepedfavyycqqygsspytfgqgtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xmhL (L:)
    eivltqspgtlslspgeratlscrasqsisssylawyqqrpgqaprlliygastratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge