PDB entry 5xm3

View 5xm3 on RCSB PDB site
Description: Crystal Structure of Methanol dehydrogenase from Methylophaga aminisulfidivorans
Class: oxidoreductase
Keywords: marine, methanol dehydrogenase, methylophaga, pyrroloquinoline quinone, Mg++, OXIDOREDUCTASE
Deposited on 2017-05-12, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose dehydrogenase
    Species: Methylophaga aminisulfidivorans MP [TaxId:1026882]
    Gene: MAMP_01209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm3a_
  • Chain 'B':
    Compound: Methanol dehydrogenase [cytochrome c] subunit 2
    Species: Methylophaga aminisulfidivorans MP [TaxId:1026882]
    Gene: MAMP_01202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm3b_
  • Chain 'C':
    Compound: glucose dehydrogenase
    Species: Methylophaga aminisulfidivorans MP [TaxId:1026882]
    Gene: MAMP_01209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm3c_
  • Chain 'D':
    Compound: Methanol dehydrogenase [cytochrome c] subunit 2
    Species: Methylophaga aminisulfidivorans MP [TaxId:1026882]
    Gene: MAMP_01202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm3d_
  • Heterogens: PQQ, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xm3A (A:)
    mremhhsrwskigtalavssalglmsgmsvandklvelsksnenwvmqgkdfsgthysta
    kqinkdnvkklrpswsfstgvlnghegaplvvngtmyihtpfpnntfaidldepgvikwe
    hkpkqdpaaravaccdvvnrglaywpgddkapamivkslldghvvalnaetgeeywkven
    gdisvgqtetaapfvakdlviqgssgaelgvrgyvtaydihtgemvwrwyatgpdadvgl
    dkdfnkhnphygqkglgtstwednawkigggtnwgwyaydpqldmfyygsgnpapwnetm
    rpgdnkwtmtiwgrdletglakfgyqktphdewdyagvnvmmlseqkdkngkmrkllthp
    drngiiytldretgdlvsankmddtanwvkkvdletglpirdpeygtrmghrsrdvcpsa
    mgfhnqgfdsydpkrelfylginhlcmdwepfmlpyragqffvganvwtypgpkgdrqng
    igsgqvkaynaitgefawekmekfsvwggttategglvfygtldgfikardadtgkllwk
    fklpsgvighpmtythkgtqyvainygvggwpavglvfdlndpsaglgavgafkelaknt
    qmgggvmvfsldgkspyddvslgeygm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm3A (A:)
    ndklvelsksnenwvmqgkdfsgthystakqinkdnvkklrpswsfstgvlnghegaplv
    vngtmyihtpfpnntfaidldepgvikwehkpkqdpaaravaccdvvnrglaywpgddka
    pamivkslldghvvalnaetgeeywkvengdisvgqtetaapfvakdlviqgssgaelgv
    rgyvtaydihtgemvwrwyatgpdadvgldkdfnkhnphygqkglgtstwednawkiggg
    tnwgwyaydpqldmfyygsgnpapwnetmrpgdnkwtmtiwgrdletglakfgyqktphd
    ewdyagvnvmmlseqkdkngkmrkllthpdrngiiytldretgdlvsankmddtanwvkk
    vdletglpirdpeygtrmghrsrdvcpsamgfhnqgfdsydpkrelfylginhlcmdwep
    fmlpyragqffvganvwtypgpkgdrqngigsgqvkaynaitgefawekmekfsvwggtt
    ategglvfygtldgfikardadtgkllwkfklpsgvighpmtythkgtqyvainygvggw
    pavglvfdlndpsaglgavgafkelakntqmgggvmvfsldgkspyddvslgeygm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xm3B (B:)
    mklktiavacsalmmlsgasavmaydgtkckaagdcweakpgfpdkikgskydpkhseke
    lnkqdaalkamekrnaerveqfkktgkwvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm3B (B:)
    ydgtkckaagdcweakpgfpdkikgskydpkhsekelnkqdaalkamekrnaerveqfkk
    tgkwvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xm3C (C:)
    mremhhsrwskigtalavssalglmsgmsvandklvelsksnenwvmqgkdfsgthysta
    kqinkdnvkklrpswsfstgvlnghegaplvvngtmyihtpfpnntfaidldepgvikwe
    hkpkqdpaaravaccdvvnrglaywpgddkapamivkslldghvvalnaetgeeywkven
    gdisvgqtetaapfvakdlviqgssgaelgvrgyvtaydihtgemvwrwyatgpdadvgl
    dkdfnkhnphygqkglgtstwednawkigggtnwgwyaydpqldmfyygsgnpapwnetm
    rpgdnkwtmtiwgrdletglakfgyqktphdewdyagvnvmmlseqkdkngkmrkllthp
    drngiiytldretgdlvsankmddtanwvkkvdletglpirdpeygtrmghrsrdvcpsa
    mgfhnqgfdsydpkrelfylginhlcmdwepfmlpyragqffvganvwtypgpkgdrqng
    igsgqvkaynaitgefawekmekfsvwggttategglvfygtldgfikardadtgkllwk
    fklpsgvighpmtythkgtqyvainygvggwpavglvfdlndpsaglgavgafkelaknt
    qmgggvmvfsldgkspyddvslgeygm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm3C (C:)
    ndklvelsksnenwvmqgkdfsgthystakqinkdnvkklrpswsfstgvlnghegaplv
    vngtmyihtpfpnntfaidldepgvikwehkpkqdpaaravaccdvvnrglaywpgddka
    pamivkslldghvvalnaetgeeywkvengdisvgqtetaapfvakdlviqgssgaelgv
    rgyvtaydihtgemvwrwyatgpdadvgldkdfnkhnphygqkglgtstwednawkiggg
    tnwgwyaydpqldmfyygsgnpapwnetmrpgdnkwtmtiwgrdletglakfgyqktphd
    ewdyagvnvmmlseqkdkngkmrkllthpdrngiiytldretgdlvsankmddtanwvkk
    vdletglpirdpeygtrmghrsrdvcpsamgfhnqgfdsydpkrelfylginhlcmdwep
    fmlpyragqffvganvwtypgpkgdrqngigsgqvkaynaitgefawekmekfsvwggtt
    ategglvfygtldgfikardadtgkllwkfklpsgvighpmtythkgtqyvainygvggw
    pavglvfdlndpsaglgavgafkelakntqmgggvmvfsldgkspyddvslgeygm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xm3D (D:)
    mklktiavacsalmmlsgasavmaydgtkckaagdcweakpgfpdkikgskydpkhseke
    lnkqdaalkamekrnaerveqfkktgkwvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm3D (D:)
    ydgtkckaagdcweakpgfpdkikgskydpkhsekelnkqdaalkamekrnaerveqfkk
    tgkwvy