PDB entry 5xm0

View 5xm0 on RCSB PDB site
Description: The mouse nucleosome structure containing H2A, H2B type3-A, H3.3, and H4
Class: structural protein/DNA
Keywords: nucleosome, chromatin, DNA-Protein complex, STRUCTURAL PROTEIN-DNA complex
Deposited on 2017-05-12, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.8699999999999997 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.3
    Species: Mus musculus [TaxId:10090]
    Gene: H3f3a, H3.3a, H3f3b, H3.3b
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone h4
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h4a, Hist1h4b, H4-53, Hist1h4c, H4-12, Hist1h4d, Hist1h4f, Hist1h4h, Hist1h4i, Hist1h4j, Hist1h4k, Hist1h4m, Hist2h4a, Hist2h4, Hist4h4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm0b_
  • Chain 'C':
    Compound: Histone H2A type 1-B
    Species: Mus musculus [TaxId:10090]
    Gene: HIST1H2AB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm0c_
  • Chain 'D':
    Compound: Histone H2B type 3-A
    Species: Mus musculus [TaxId:10090]
    Gene: Hist3h2ba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm0d_
  • Chain 'E':
    Compound: Histone H3.3
    Species: Mus musculus [TaxId:10090]
    Gene: H3f3a, H3.3a, H3f3b, H3.3b
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: histone h4
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h4a, Hist1h4b, H4-53, Hist1h4c, H4-12, Hist1h4d, Hist1h4f, Hist1h4h, Hist1h4i, Hist1h4j, Hist1h4k, Hist1h4m, Hist2h4a, Hist2h4, Hist4h4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm0f_
  • Chain 'G':
    Compound: Histone H2A type 1-B
    Species: Mus musculus [TaxId:10090]
    Gene: HIST1H2AB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm0g_
  • Chain 'H':
    Compound: Histone H2B type 3-A
    Species: Mus musculus [TaxId:10090]
    Gene: Hist3h2ba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xm0h_
  • Chain 'I':
    Compound: DNA (146-mer)
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: DNA (146-mer)
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xm0B (B:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm0B (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xm0C (C:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm0C (C:)
    aktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xm0D (D:)
    gshmpepsrstpapkkgskkaitkaqkkdgkkrkrgrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiaseasrlahynkrstitsrevqtavrlllpgelakhavsegtk
    avtkytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm0D (D:)
    rgrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstit
    srevqtavrlllpgelakhavsegtkavtkytss
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xm0F (F:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm0F (F:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xm0G (G:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm0G (G:)
    ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5xm0H (H:)
    gshmpepsrstpapkkgskkaitkaqkkdgkkrkrgrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiaseasrlahynkrstitsrevqtavrlllpgelakhavsegtk
    avtkytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xm0H (H:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
    evqtavrlllpgelakhavsegtkavtkytss
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.