PDB entry 5xlw

View 5xlw on RCSB PDB site
Description: Mycobacterium tuberculosis Pantothenate kinase mutant F247A/F254A
Class: transferase
Keywords: Homodimer, CoA biosynthesis, Nucleotide binding, Concerted movement, Structural transformation, TRANSFERASE
Deposited on 2017-05-11, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pantothenate kinase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: coaA, Rv1092c, MTV017.45c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WPA7 (Start-311)
      • engineered mutation (246)
      • engineered mutation (253)
    Domains in SCOPe 2.07: d5xlwa_
  • Chain 'B':
    Compound: pantothenate kinase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: coaA, Rv1092c, MTV017.45c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xlwb_
  • Heterogens: EDO, 1PE, SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xlwA (A:)
    msrlsepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarli
    hlqvaarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhh
    prvdlvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshl
    hydiipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrfl
    amrttaaadpeshahhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkda
    dhsinrlrlrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xlwA (A:)
    pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
    rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
    ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
    gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtta
    aadpeshahhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinr
    lrlrkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xlwB (B:)
    msrlsepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarli
    hlqvaarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhh
    prvdlvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshl
    hydiipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrfl
    amrttaaadpeshahhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkda
    dhsinrlrlrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xlwB (B:)
    pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
    rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
    ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
    gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamdsqa
    vvaareiwrtinrpnlvenilptrpratlvlrkdadhsinrlrlrkl