PDB entry 5xli

View 5xli on RCSB PDB site
Description: Structure of anti-Angiotensin II type2 receptor antibody (D5711-4A03)
Class: immune system
Keywords: antigbody, IgG, Fab, IMMUNE SYSTEM
Deposited on 2017-05-10, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'a':
    Compound: FabL
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XLI (0-212)
    Domains in SCOPe 2.07: d5xlia1, d5xlia2
  • Chain 'b':
    Compound: FabL
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XLI (0-212)
    Domains in SCOPe 2.07: d5xlib1, d5xlib2
  • Chain 'c':
    Compound: FabH
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XLI (0-219)
  • Chain 'd':
    Compound: FabH
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XLI (0-219)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xlia (a:)
    divltqspaimsaspgekvtmtcsasssvtymywyqqkpgssprlliydtsnlasgvpvr
    fsgsgsgtsysltisrmeaedaatfycqqwssypltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xlib (b:)
    divltqspaimsaspgekvtmtcsasssvtymywyqqkpgssprlliydtsnlasgvpvr
    fsgsgsgtsysltisrmeaedaatfycqqwssypltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.