PDB entry 5xla

View 5xla on RCSB PDB site
Description: The structure of hemagglutinin G228S mutant from an avian-origin H4N6 influenza virus in complex with human receptor analog LSTc
Class: viral protein
Keywords: H4 hemagglutinin, influenza virus, receptor binding, VIRAL PROTEIN
Deposited on 2017-05-10, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:385590]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3KF09
      • engineered mutation (224)
    Domains in SCOPe 2.07: d5xlaa1, d5xlaa2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:385590]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3KF09
      • engineered mutation (224)
    Domains in SCOPe 2.07: d5xlab1, d5xlab2
  • Heterogens: NAG, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xlaA (A:)
    qnytgnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtc
    diingalgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaee
    fqwntvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvh
    hpstdteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdli
    vfntignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriav
    gdcpryvkqgslklatgmrnipekasrglfgaiagfiengwqglidgwygfrhqnaegtg
    taadlkstqaaidqingklnrliektndkyhqiekefeqvegriqdlekyvedtkidlws
    ynaellvalenqhtidvtdsemnklfervrrqlrenaedkgngcfeifhkcdnnciesir
    ngtydhdiyrdeainnrfqiqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xlaA (A:)
    gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
    galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
    tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
    dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt
    ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
    ryvkqgslklatgmrnipelfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstq
    aaidqingklnrliektndkyhqiekefeqvegriqdlekyvedtkidlwsynaellval
    enqhtidvtdsemnklfervrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiy
    rdeainnrfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xlaB (B:)
    qnytgnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtc
    diingalgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaee
    fqwntvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvh
    hpstdteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdli
    vfntignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriav
    gdcpryvkqgslklatgmrnipekasrglfgaiagfiengwqglidgwygfrhqnaegtg
    taadlkstqaaidqingklnrliektndkyhqiekefeqvegriqdlekyvedtkidlws
    ynaellvalenqhtidvtdsemnklfervrrqlrenaedkgngcfeifhkcdnnciesir
    ngtydhdiyrdeainnrfqiqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xlaB (B:)
    gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
    galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
    tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
    dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt
    ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
    ryvkqgslklatgmrnipelfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstq
    aaidqingklnrliektndkyhqiekefeqvegriqdlekyvedtkidlwsynaellval
    enqhtidvtdsemnklfervrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiy
    rdeainnrfq