PDB entry 5xl2

View 5xl2 on RCSB PDB site
Description: The structure of hemagglutininfrom a swine-origin H4N6 influenza virus
Class: viral protein
Keywords: H4 hemagglutinin, influenza virus, receptor binding, VIRAL PROTEIN
Deposited on 2017-05-10, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Ontario/01911-1/99 (H4N6)) [TaxId:137611]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xl2a1, d5xl2a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Ontario/01911-1/99 (H4N6)) [TaxId:137611]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xl2b1, d5xl2b2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Ontario/01911-1/99 (H4N6)) [TaxId:137611]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xl2c1, d5xl2c2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xl2A (A:)
    qnytgnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtc
    divngalgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaee
    fqwntvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvh
    hpstdteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdli
    vfntignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisi
    gdcpkyvkqgslklatgmrnipekatrglfgaiagfiengwqglidgwygfrhqnaegtg
    taadlkstqaaidqingklnrliekpnekyhqiekefeqvegriqdlekyvedtkidlws
    ynaellvalenqhtidvtdsemnklfervrhqlrenaedkgngcfeifhqcdnsciesir
    ngtydhdiyrdeainnrfqiqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xl2A (A:)
    gnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtcdivn
    galgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaeefqwn
    tvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvhhpst
    dteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdlivfnt
    ignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisigdcp
    kyvkqgslklatgmrnipeiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaid
    qingklnrliekpnekyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqh
    tidvtdsemnklfervrhqlrenaedkgngcfeifhqcdnsciesirngtydhdiyrdea
    innrfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xl2B (B:)
    qnytgnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtc
    divngalgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaee
    fqwntvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvh
    hpstdteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdli
    vfntignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisi
    gdcpkyvkqgslklatgmrnipekatrglfgaiagfiengwqglidgwygfrhqnaegtg
    taadlkstqaaidqingklnrliekpnekyhqiekefeqvegriqdlekyvedtkidlws
    ynaellvalenqhtidvtdsemnklfervrhqlrenaedkgngcfeifhqcdnsciesir
    ngtydhdiyrdeainnrfqiqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xl2B (B:)
    gnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtcdivn
    galgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaeefqwn
    tvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvhhpst
    dteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdlivfnt
    ignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisigdcp
    kyvkqgslklatgmrnipeiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaid
    qingklnrliekpnekyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqh
    tidvtdsemnklfervrhqlrenaedkgngcfeifhqcdnsciesirngtydhdiyrdea
    innrfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xl2C (C:)
    qnytgnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtc
    divngalgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaee
    fqwntvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvh
    hpstdteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdli
    vfntignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisi
    gdcpkyvkqgslklatgmrnipekatrglfgaiagfiengwqglidgwygfrhqnaegtg
    taadlkstqaaidqingklnrliekpnekyhqiekefeqvegriqdlekyvedtkidlws
    ynaellvalenqhtidvtdsemnklfervrhqlrenaedkgngcfeifhqcdnsciesir
    ngtydhdiyrdeainnrfqiqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xl2C (C:)
    gnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtcdivn
    galgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaeefqwn
    tvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvhhpst
    dteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdlivfnt
    ignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisigdcp
    kyvkqgslklatgmrnipegfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqi
    ngklnrliekpnekyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhti
    dvtdsemnklfervrhqlrenaedkgngcfeifhqcdnsciesirngtydhdiyrdeain
    nrfq