PDB entry 5xl1

View 5xl1 on RCSB PDB site
Description: The structure of hemagglutinin from an avian-origin H4N6 influenza virus
Class: viral protein
Keywords: H4 hemagglutinin, influenza virus, receptor binding, VIRAL PROTEIN
Deposited on 2017-05-10, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Duck/Czechoslovakia/1956 H4N6) [TaxId:385590]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xl1a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Duck/Czechoslovakia/1956 H4N6) [TaxId:385590]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xl1b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Duck/Czechoslovakia/1956 H4N6) [TaxId:385590]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xl1c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Duck/Czechoslovakia/1956 H4N6) [TaxId:385590]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xl1d_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xl1A (A:)
    qnytgnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtc
    diingalgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaee
    fqwntvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvh
    hpstdteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqsgrvsfywtivepgdli
    vfntignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriav
    gdcpryvkqgslklatgmrnipekasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xl1A (A:)
    gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
    galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
    tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
    dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqsgrvsfywtivepgdlivfnt
    ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
    ryvkqgslklatgmrnipe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xl1B (B:)
    qnytgnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtc
    diingalgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaee
    fqwntvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvh
    hpstdteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqsgrvsfywtivepgdli
    vfntignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriav
    gdcpryvkqgslklatgmrnipekasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xl1B (B:)
    gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
    galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
    tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
    dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqsgrvsfywtivepgdlivfnt
    ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
    ryvkqgslklatgmrnipe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xl1C (C:)
    glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
    dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
    rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfqiqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xl1C (C:)
    glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
    dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
    rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xl1D (D:)
    glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
    dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
    rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfqiqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xl1D (D:)
    glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
    dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
    rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq