PDB entry 5xkw

View 5xkw on RCSB PDB site
Description: myglobin mutant F43Y/F46Y
Class: oxygen storage
Keywords: myoglobin, OXYGEN STORAGE
Deposited on 2017-05-09, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (42)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d5xkwa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xkwA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekydrykhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg