PDB entry 5xk2

View 5xk2 on RCSB PDB site
Description: Crystal structure of mono- and diacylglycerol lipase from Aspergillus oryzae
Class: hydrolase
Keywords: closed conformation, HYDROLASE
Deposited on 2017-05-05, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diacylglycerol lipase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: mdlB, OAory_01019780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xk2a_
  • Chain 'B':
    Compound: Diacylglycerol lipase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: mdlB, OAory_01019780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xk2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xk2A (A:)
    yptaidvrdipttqledfkfwvqyaaatycpnnyvakdgeklncsvgncpdveaagstvk
    lsfsddtitdtagfvavdntnkaivvafrgsysirnwvtdatfpqtdpglcdgckaelgf
    wtawkvvrdriiktldelkpehsdykivvvghslgaaiaslaaadlrtknydailyayaa
    prvankplaefitnqgnnyrfthnddpvpklplltmgyvhispeyyitapdnttvtdnqv
    tvldgyvnfkgntgtsgglpdllafhshvwyfihadackgpglplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xk2A (A:)
    ipttqledfkfwvqyaaatycpnnyvakdgeklncsvgncpdveaagstvklsfsddtit
    dtagfvavdntnkaivvafrgsysirnwvtdatfpqtdpglcdgckaelgfwtawkvvrd
    riiktldelkpehsdykivvvghslgaaiaslaaadlrtknydailyayaaprvankpla
    efitnqgnnyrfthnddpvpklplltmgyvhispeyyitapdnttvtdnqvtvldgyvnf
    kgntgtsgglpdllafhshvwyfihadackg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xk2B (B:)
    yptaidvrdipttqledfkfwvqyaaatycpnnyvakdgeklncsvgncpdveaagstvk
    lsfsddtitdtagfvavdntnkaivvafrgsysirnwvtdatfpqtdpglcdgckaelgf
    wtawkvvrdriiktldelkpehsdykivvvghslgaaiaslaaadlrtknydailyayaa
    prvankplaefitnqgnnyrfthnddpvpklplltmgyvhispeyyitapdnttvtdnqv
    tvldgyvnfkgntgtsgglpdllafhshvwyfihadackgpglplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xk2B (B:)
    pttqledfkfwvqyaaatycpnnyvakdgeklncsvgncpdveaagstvklsfsddtitd
    tagfvavdntnkaivvafrgsysirnwvtdatfpqtdpglcdgckaelgfwtawkvvrdr
    iiktldelkpehsdykivvvghslgaaiaslaaadlrtknydailyayaaprvankplae
    fitnqgnnyrfthnddpvpklplltmgyvhispeyyitapdnttvtdnqvtvldgyvnfk
    gntgtsgglpdllafhshvwyfihadack