PDB entry 5xjv

View 5xjv on RCSB PDB site
Description: Two intermediate states of conformation switch in dual specificity phosphatase 13a
Class: hydrolase
Keywords: DUSP13A, PTP, conformation switch, Catalytic Domain, HYDROLASE
Deposited on 2017-05-04, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein phosphatase 13 isoform A
    Species: Homo sapiens [TaxId:9606]
    Gene: DUSP13, BEDP, DUSP13A, MDSP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8I1 (Start-184)
      • engineered mutation (17)
      • engineered mutation (34)
      • engineered mutation (76)
      • engineered mutation (128)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d5xjva_
  • Chain 'B':
    Compound: Dual specificity protein phosphatase 13 isoform A
    Species: Homo sapiens [TaxId:9606]
    Gene: DUSP13, BEDP, DUSP13A, MDSP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8I1 (Start-184)
      • engineered mutation (17)
      • engineered mutation (34)
      • engineered mutation (76)
      • engineered mutation (128)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d5xjvb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xjvA (A:)
    maetslpelggedkatpapsileleellragkssasrvdevwpnlfigdaatannrfelw
    klgithvlnaahkglyaqggpdfygssvsylgvpahdlpdfdisayfssaadfihralnt
    pgakvlvhsvvgvsrsatlvlaylmlhqrlslrqavitvrqhrwvfpnrgflhqlarldq
    qlrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjvA (A:)
    tpapsileleellragkssasrvdevwpnlfigdaatannrfelwklgithvlnaahkgl
    yaqggpdfygssvsylgvpahdlpdfdisayfssaadfihralntpgakvlvhsvvgvsr
    satlvlaylmlhqrlslrqavitvrqhrwvfpnrgflhqlarldqqlrga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xjvB (B:)
    maetslpelggedkatpapsileleellragkssasrvdevwpnlfigdaatannrfelw
    klgithvlnaahkglyaqggpdfygssvsylgvpahdlpdfdisayfssaadfihralnt
    pgakvlvhsvvgvsrsatlvlaylmlhqrlslrqavitvrqhrwvfpnrgflhqlarldq
    qlrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjvB (B:)
    atpapsileleellragkssasrvdevwpnlfigdaatannrfelwklgithvlnaahkg
    lyaqggpdfygssvsylgvpahdlpdfdisayfssaadfihralntpgakvlvhsvvgvs
    rsatlvlaylmlhqrlslrqavitvrqhrwvfpnrgflhqlarldqqlrga