PDB entry 5xjf

View 5xjf on RCSB PDB site
Description: Crystal structure of fucosylated IgG Fc Y296W mutant complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa
Class: immune system
Keywords: immune system, complex, fc fragment, igg, receptor, cd16, gamma
Deposited on 2017-05-01, released 2017-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5
      • engineered mutation (71)
    Domains in SCOPe 2.06: d5xjfa1, d5xjfa2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5
      • engineered mutation (71)
    Domains in SCOPe 2.06: d5xjfb1, d5xjfb2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A, CD16A, FCG3, FCGR3, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (155)
      • engineered mutation (166)
    Domains in SCOPe 2.06: d5xjfc1
  • Heterogens: NAG, BMA, MAN, GAL, FUC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xjfA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjfA (A:)
    papellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnakt
    kpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvy
    tlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysk
    ltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xjfB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjfB (B:)
    papellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnakt
    kpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvy
    tlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysk
    ltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xjfC (C:)
    edlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaat
    vddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvt
    ylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjfC (C:)
    vflepqwyrvlekdsvtlkcqwfhneslissqyfidaatvddsgeyrcqtstlsdpvqle
    vhigwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkat
    lkdsgsyfcrglvgsknvssetvqititq