PDB entry 5xia

View 5xia on RCSB PDB site
Description: structures of d-xylose isomerase from arthrobacter strain b3728 containing the inhibitors xylitol and d-sorbitol at 2.5 angstroms and 2.3 angstroms resolution, respectively
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1989-07-05, released 1990-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.135
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-xylose isomerase
    Species: Arthrobacter sp. [TaxId:1669]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12070 (0-392)
      • conflict (29)
      • conflict (62)
      • conflict (77)
    Domains in SCOPe 2.06: d5xiaa_
  • Chain 'B':
    Compound: d-xylose isomerase
    Species: Arthrobacter sp. [TaxId:1669]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12070 (0-392)
      • conflict (29)
      • conflict (62)
      • conflict (77)
    Domains in SCOPe 2.06: d5xiab_
  • Heterogens: XYL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xiaA (A:)
    vqptpadhftfglwtvgwtgadpfgvatranldpveavhklaelgaygitfhdndlipfd
    ataaerekilgdfnqaladtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlhn
    idlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlrialep
    kpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaeklf
    hidlngqrgikydqdlvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdgy
    dgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnds
    asfagfdaeaaaernfafirlnqlaiehllgsr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xiaB (B:)
    vqptpadhftfglwtvgwtgadpfgvatranldpveavhklaelgaygitfhdndlipfd
    ataaerekilgdfnqaladtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlhn
    idlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlrialep
    kpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaeklf
    hidlngqrgikydqdlvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdgy
    dgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnds
    asfagfdaeaaaernfafirlnqlaiehllgsr