PDB entry 5xhs

View 5xhs on RCSB PDB site
Description: Crystal structure of SIRT5 complexed with a fluorogenic small-molecule substrate SuBKA
Class: hydrolase
Keywords: Sirtuin, Fluorogenic Small Molecule Substrates, HYDROLASE
Deposited on 2017-04-24, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent protein deacylase sirtuin-5, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT5, SIR2L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xhsa_
  • Heterogens: PHQ, SLL, MCM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xhsA (A:)
    mghhhhhhsgenlyfqgasarpsssmadfrkffakakhiviisgagvsaesgvptfrgag
    gywrkwqaqdlatplafahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrr
    vvvitqnidelhrkagtknlleihgslfktrctscgvvaenykspicpalsgkgapepgt
    qdasipveklprceeagcggllrphvvwfgenldpaileevdrelahcdlclvvgtssvv
    ypaamfapqvaargvpvaefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xhsA (A:)
    psssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahnp
    srvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknll
    eihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggl
    lrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefn
    tettfrfhfqgpcgttlpeala