PDB entry 5xhh

View 5xhh on RCSB PDB site
Description: crystal structure of Hcp1 from Salmonella typhimurium
Class: unknown function
Keywords: effector protein, UNKNOWN FUNCTION
Deposited on 2017-04-21, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciK, BKC11_01420, BKC12_01390, BLM41_12425, DD95_17690, SEETMRM10961_1345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xhha_
  • Chain 'B':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciK, BKC11_01420, BKC12_01390, BLM41_12425, DD95_17690, SEETMRM10961_1345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xhhb_
  • Chain 'C':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciK, BKC11_01420, BKC12_01390, BLM41_12425, DD95_17690, SEETMRM10961_1345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xhhc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xhhA (A:)
    maydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnldfdh
    yidraspnlfkycasgkhipqailvmrkaggnpleylkytftdlivavvspsgshdgeia
    sretvelsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xhhA (A:)
    maydiflkidgidgesmddkhkneievlswrwnihqestmhagsglkvsvtnldfdhyid
    raspnlfkycasgkhipqailvmrkanpleylkytftdlivavvspsgshdgeiasretv
    elsfstvkqeyvvqggtitagydfkankei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xhhB (B:)
    maydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnldfdh
    yidraspnlfkycasgkhipqailvmrkaggnpleylkytftdlivavvspsgshdgeia
    sretvelsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xhhB (B:)
    aydiflkidgidgesmddkhkneievlswrwnihqvsvtnldfdhyidraspnlfkycas
    gkhipqailvmrkaggnpleylkytftdlivavvspsgshdgeiasretvelsfstvkqe
    yvvgtitagydfkankei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xhhC (C:)
    maydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnldfdh
    yidraspnlfkycasgkhipqailvmrkaggnpleylkytftdlivavvspsgshdgeia
    sretvelsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xhhC (C:)
    maydiflkidgidgesmddkhkneievlswrwnihqvsvtnldfdhyidraspnlfkyca
    sgkhipqailvmrkaggnpleylkytftdlivavvspsgshdgeiasretvelsfstvkq
    eyvvqggtitagydfkankei