PDB entry 5xgq

View 5xgq on RCSB PDB site
Description: Crystal structure of apo form (free-state) Mycobacterium tuberculosis methionyl-tRNA synthetase
Class: ligase
Keywords: Methionyl-tRNA Synthetase, Protein translation, Mycobacterium tuberculosis, Anticodon-binding domain of tRNA, LIGASE
Deposited on 2017-04-15, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine-tRNA ligase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: metG, MRA_1016
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U150 (8-End)
      • expression tag (3-7)
    Domains in SCOPe 2.07: d5xgqa1, d5xgqa2, d5xgqa3
  • Chain 'B':
    Compound: Methionine-tRNA ligase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: metG, MRA_1016
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U150 (8-End)
      • expression tag (3-7)
    Domains in SCOPe 2.07: d5xgqb1, d5xgqb2, d5xgqb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xgqA (A:)
    mghhhhhhmkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehg
    lkvaqaaaaagvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsa
    agdiyldnysgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdk
    llahyhanpdfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdal
    tnyltgagfpdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgf
    lhnrgekmsksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdla
    nelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlale
    aiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesag
    kildllgqapnqrsfaavgvrltpgtalppptgvfpryqppqppegkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgqA (A:)
    hhhhhmkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdgvptaa
    larrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldnysgwysvr
    derffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhanpdfiapet
    rrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgagfpdtdsel
    frrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrivdpvalaealg
    vdqvryfllrevpfgqdgsysdeaivtrintdlanelgnlaqrslsmvaknldgrvpnpg
    efadadaallatadgllervrghfdaqamhlaleaiwlmlgdankyfsvqqpwvlrkses
    eadqarfrttlyvtcevvriaalliqpvmpesagkildllgqapnqrsfaavgvrltpgt
    alppptgvfpryqpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xgqB (B:)
    mghhhhhhmkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehg
    lkvaqaaaaagvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsa
    agdiyldnysgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdk
    llahyhanpdfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdal
    tnyltgagfpdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgf
    lhnrgekmsksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdla
    nelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlale
    aiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesag
    kildllgqapnqrsfaavgvrltpgtalppptgvfpryqppqppegkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgqB (B:)
    hhhhhmkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdgvptaa
    larrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldnysgwysvr
    derffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhanpdfiapet
    rrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgagfpdtdsel
    frrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrgivdpvalaeal
    gvdqvryfllrevpfgqdgsysdeaivtrintdlanelgnlaqrslsmvaknldgrvpnp
    gefadadaallatadgllervrghfdaqamhlaleaiwlmlgdankyfsvqqpwvlrkse
    seadqarfrttlyvtcevvriaalliqpvmpesagkildllgqapnqrsfaavgvrltpg
    talppptgvfpryqpp