PDB entry 5xgo

View 5xgo on RCSB PDB site
Description: The Ferritin E-Domain: Toward Understanding Its Role in Protein Cage Assembly Through the Crystal Structure of a Maxi-/Mini-Ferritin Chimera
Class: oxidoreductase
Keywords: Ferritin, Protein engineering, protein cage, OXIDOREDUCTASE
Deposited on 2017-04-14, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgoa_
  • Chain 'B':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgob_
  • Chain 'C':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgoc_
  • Chain 'D':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgod_
  • Chain 'E':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgoe_
  • Chain 'F':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgof_
  • Chain 'G':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgog_
  • Chain 'H':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgoh_
  • Chain 'I':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgoi_
  • Chain 'J':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgoj_
  • Chain 'K':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgok_
  • Chain 'L':
    Compound: DNA protection during starvation protein,Bacterioferritin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-176)
      • linker (177-178)
    • Uniprot P0ABD3 (179-End)
    Domains in SCOPe 2.07: d5xgol_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xgoA (A:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoA (A:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xgoB (B:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoB (B:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xgoC (C:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoC (C:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xgoD (D:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoD (D:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xgoE (E:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoE (E:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xgoF (F:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoF (F:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xgoG (G:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoG (G:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5xgoH (H:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoH (H:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5xgoI (I:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoI (I:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5xgoJ (J:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoJ (J:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5xgoK (K:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoK (K:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiecnldl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5xgoL (L:)
    mahhhhhhvddddkmstaklvkskatnllytrndvsdsekkatvellnrqviqfidlsli
    tkqahwnmrganfiavhemldgfrtalidhldtmaeravqlggvalgttqvinsktplks
    ypldihnvqdhlkeladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnl
    dliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgoL (L:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnldl