PDB entry 5xgn

View 5xgn on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 T790M/C797S in complex with Go6976
Class: transferase/transferase inhibitor
Keywords: EGFR T790M/C797S, Go6976, Inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-04-14, released 2017-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5xgna_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5xgnb_
  • Heterogens: 85X, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xgnA (A:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgnA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
    pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
    pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhvdadeyli
    pq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xgnB (B:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgnB (B:)
    eapnqallrilketefkkikvlgsgafgtvykglwipgekvkipvaikelreatspkank
    eildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdnigsqyllnw
    cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklekeyhaeggkvpikwm
    alesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppicti
    dvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermsptdsnfyralmvv
    dadeylip