PDB entry 5xgg

View 5xgg on RCSB PDB site
Description: Crystal Structure C-terminal SH3 domain of Myosin IB from Entamoeba histolytica
Class: contractile protein
Keywords: SH3, MyosinI, Entamoeba histolytica, EhMySH3, CONTRACTILE PROTEIN
Deposited on 2017-04-13, released 2017-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58-63)
    Domains in SCOPe 2.06: d5xgga1, d5xgga2, d5xgga3
  • Chain 'B':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58-63)
    Domains in SCOPe 2.06: d5xggb1, d5xggb2, d5xggb3
  • Chain 'C':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58-63)
    Domains in SCOPe 2.06: d5xggc1, d5xggc2, d5xggc3
  • Chain 'D':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58-63)
    Domains in SCOPe 2.06: d5xggd1, d5xggd2, d5xggd3
  • Chain 'E':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58-64)
    Domains in SCOPe 2.06: d5xgge1, d5xgge2, d5xgge3
  • Chain 'F':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xggf1, d5xggf2, d5xggf3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xggA (A:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xggA (A:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xggB (B:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xggB (B:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xggC (C:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xggC (C:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xggD (D:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xggD (D:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xggE (E:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xggE (E:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xggF (F:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xggF (F:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil