PDB entry 5xg9

View 5xg9 on RCSB PDB site
Description: Crystal Structure of PEG-bound SH3 domain of Myosin IB from Entamoeba histolytica
Class: contractile protein
Keywords: SH3, MyosinI, Entamoeba histolytica, PEG-bound SH3 complex, CONTRACTILE PROTEIN
Deposited on 2017-04-13, released 2017-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xg9a1, d5xg9a2, d5xg9a3
  • Chain 'B':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xg9b1, d5xg9b2, d5xg9b3
  • Chain 'C':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xg9c1, d5xg9c2, d5xg9c3
  • Chain 'D':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xg9d1, d5xg9d2, d5xg9d3
  • Chain 'E':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xg9e1, d5xg9e2, d5xg9e3
  • Chain 'F':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5xg9f1, d5xg9f2
  • Chain 'G':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xg9g1, d5xg9g2, d5xg9g3
  • Chain 'H':
    Compound: Unconventional myosin IB
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: CL6EHI_110810, EHI_110810
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LUC7 (3-57)
      • expression tag (0-2)
      • expression tag (58)
    Domains in SCOPe 2.06: d5xg9h1, d5xg9h2, d5xg9h3
  • Heterogens: 1PE, PEU, PG6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xg9A (A:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9A (A:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xg9B (B:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9B (B:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xg9C (C:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9C (C:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xg9D (D:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9D (D:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xg9E (E:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9E (E:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xg9F (F:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9F (F:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkei
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xg9G (G:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9G (G:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5xg9H (H:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeile
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xg9H (H:)
    asmlpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkeil