PDB entry 5xg8

View 5xg8 on RCSB PDB site
Description: Galectin-13/Placental Protein 13 variant R53H crystal structure
Class: sugar binding protein
Keywords: disulfide bond, SUGAR BINDING PROTEIN
Deposited on 2017-04-12, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding soluble lectin 13
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS13, PLAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHV8 (0-137)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d5xg8a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xg8A (A:)
    sslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafhfrvhfgnh
    vvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrippsfv
    kmvqvsrdisltsvcvcn