PDB entry 5xg4

View 5xg4 on RCSB PDB site
Description: Crystal structure of uPA in complex with quercetin
Class: hydrolase/hydrolase inhibitor
Keywords: Serine proteases, uPA, pepetide inhibitors, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-04-11, released 2017-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-245)
      • conflict (120)
      • conflict (143)
    Domains in SCOPe 2.08: d5xg4u_
  • Heterogens: QUE, PG6, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xg4U (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtk