PDB entry 5xfw

View 5xfw on RCSB PDB site
Description: Crystal structures of FMN-free form of dihydroorotate dehydrogenase from Trypanosoma brucei
Class: oxidoreductase
Keywords: Neglected Tropical Diseases Flavin Enzyme Pyrimidine metabolism, OXIDOREDUCTASE
Deposited on 2017-04-11, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (21-333)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfwa_
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (21-333)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfwb_
  • Chain 'C':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (21-End)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfwc_
  • Chain 'D':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (21-333)
      • expression tag (19-20)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfwd1, d5xfwd2
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xfwA (A:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfwA (A:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xfwB (B:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfwB (B:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xfwC (C:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfwC (C:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xfwD (D:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfwD (D:)
    gsmslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepr
    yfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpit
    kekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdma
    aavlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaff
    rrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkg
    yktldefrgrvktmd