PDB entry 5xfv

View 5xfv on RCSB PDB site
Description: Crystal structures of FMN-bound form of dihydroorotate dehydrogenase from Trypanosoma brucei
Class: oxidoreductase
Keywords: Neglected Tropical Diseases Flavin Enzyme Pyrimidine metabolism, OXIDOREDUCTASE
Deposited on 2017-04-11, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei strain 927/4 GUTat10.1 [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (21-End)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfva_
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei strain 927/4 GUTat10.1 [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfvb_
  • Chain 'C':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei strain 927/4 GUTat10.1 [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (21-End)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfvc_
  • Chain 'D':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma brucei brucei strain 927/4 GUTat10.1 [TaxId:185431]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (21-333)
      • engineered mutation (135)
    Domains in SCOPe 2.07: d5xfvd_
  • Heterogens: FMN, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xfvA (A:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfvA (A:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xfvB (B:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfvB (B:)
    slkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfg
    lplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitkek
    gtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaav
    lndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrrc
    pdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgykt
    ldefrgrvktm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xfvC (C:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfvC (C:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xfvD (D:)
    mahhhhhhsaalevlfqgpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesg
    sligksctlaprtgnpepryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsm
    sglsveesvemvkklvpitkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayg
    lpfgvkmppyfdiahfdmaaavlndfplvkfitcvnsignglvidpanetvvikpkqgfg
    glggkyvlptalanvnaffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdeg
    piifarlnkelqeimtnkgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfvD (D:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktmd