PDB entry 5xfi

View 5xfi on RCSB PDB site
Description: Crystal structure of Calsepa lectin in complex with biantennary N-glycan
Class: sugar binding protein
Keywords: Lectin, Jacalin-related lectin, N-glycan, Glycobiology, SUGAR BINDING PROTEIN
Deposited on 2017-04-10, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xfia_
  • Chain 'B':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xfib_
  • Heterogens: NAG, BMA, MAN, GAL, SO4, EDO, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xfiA (A:)
    mavpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtit
    vggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgt
    pfssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfiA (A:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssanvvgneivgflgrsgyyvdaigtynrhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xfiB (B:)
    mavpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtit
    vggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgt
    pfssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfiB (B:)
    avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
    ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
    fssanvvgneivgflgrsgyyvdaigtynrhk