PDB entry 5xfd

View 5xfd on RCSB PDB site
Description: Serial femtosecond X-ray structure of Agrocybe cylindracea galectin with lactose solved by Se-SAD using XFEL (refined against 60,000 patterns)
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2017-04-10, released 2017-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding lectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XFD
    Domains in SCOPe 2.06: d5xfda1, d5xfda2
  • Chain 'B':
    Compound: Galactoside-binding lectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XFD
    Domains in SCOPe 2.06: d5xfdb1, d5xfdb2
  • Heterogens: A2G, GAL, FUC, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xfdA (A:)
    mdykddddkhmttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntal
    nllsengayllhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdh
    gdkyqvvinektviqytkqisgttsslsynstegtsifstvveavtytglaklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfdA (A:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xfdB (B:)
    mdykddddkhmttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntal
    nllsengayllhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdh
    gdkyqvvinektviqytkqisgttsslsynstegtsifstvveavtytglaklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xfdB (B:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsnntalnllsengayllhiafrl
    qenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviqyt
    kqisgttsslsynstsifstvveavtytgla