PDB entry 5xf8

View 5xf8 on RCSB PDB site
Description: cryo-em structure of the cdt1-mcm2-7 complex in amppnp state
Deposited on 2017-04-09, released 2017-05-03
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: EM
Resolution: 7.1 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '2':
    Compound: DNA replication licensing factor mcm2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MCM2, YBL023C, YBL0438
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: DNA replication licensing factor MCM3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MCM3, YEL032W, SYGP-ORF23
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: DNA replication licensing factor MCM4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MCM4, CDC54, HCD21, YPR019W, YP9531.13
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: Minichromosome maintenance protein 5
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MCM5, CDC46, YLR274W, L9328.1
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: DNA replication licensing factor MCM6
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MCM6, YGL201C
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: DNA replication licensing factor MCM7
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MCM7, CDC47, YBR202W, YBR1441
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cell division cycle protein CDT1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: TAH11, CDT1, SID2, YJR046W, J1641
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '2':
    Sequence, based on SEQRES records:
    >5xf82 (2:)
    msdnrrrrreeddsdsenelppsspqqhfrggmnpvsspigspdminpegddnevddvpd
    ideveeqmnevdlmddnmyedyaadhnrdrydpdqvddreqqelslserrridaqlnerd
    rllrnvayiddedeeqegaaqldemglpvqrrrrrrqyedlensdddllsdmdidplree
    ltleslsnvkansysewitqpnvsrtiarelksflleytdetgrsvygarirtlgemnse
    slevnyrhlaeskailalflakcpeemlkifdlvameatelhypdyarihseihvrisdf
    ptiyslrelresnlsslvrvtgvvtrrtgvfpqlkyvkfnclkcgsilgpffqdsneeir
    isfctnckskgpfrvngektvyrnyqrvtlqeapgtvppgrlprhrevilladlvdvskp
    geevevtgiyknnydgnlnakngfpvfatiieansikrregntanegeegldvfswteee
    erefrkisrdrgiidkiissmapsiyghrdiktavacslfggvpknvngkhsirgdinvl
    llgdpgtaksqilkyvektahravfatgqgasavgltasvrkdpitkewtleggalvlad
    kgvclidefdkmndqdrtsiheameqqsisiskagivttlqarcsiiaaanpnggrynst
    lplaqnvsltepilsrfdilcvvrdlvdeeaderlatfvvdshvrshpendedregeelk
    nngesaieqgedeineqlnarqrrlqrqrkkeeeispipqellmkyihyartkiypklhq
    mdmdkvsrvyadlrresistgsfpitvrhlesilriaesfakmrlsefvssydldraikv
    vvdsfvdaqkvsvrrqlrrsfaiytlgh
    

    Sequence, based on observed residues (ATOM records):
    >5xf82 (2:)
    pnvsrtiarelksflleytdetgrsvygarirtlgemnseslevnyrhlaeskailalfl
    akcpeemlkifdlvameatelhypdyarihseihvrisdfptiyslrelresnlsslvrv
    tgvvtrrtgvfpqlkyvkfnclkcgsilgpffqdsneeirisfctnckskgpfrvngekt
    vyrnyqrvtlqeapgtvppgrlprhrevilladlvdvskpgeevevtgiyknnydatiie
    ansikrrevfswteeeerefrkisrdrgiidkiissmapsiyghrdiktavacslfggvp
    knvngkhsirgdinvlllgdpgtaksqilkyvektahravfatgqgasavgltasvrkdp
    itkewtleggalvladkgvclidefdkmndqdrtsiheameqqsisiskagivttlqarc
    siiaaanpnggrynstlplaqnvsltepilsrfdilcvvrdlvdeeaderlatfvvdshv
    rsspipqellmkyihyartkiypklhqmdmdkvsrvyadlrresistgsfpitvrhlesi
    lriaesfakmrlsefvssydldraikvvvdsfvdaqkvsvrrqlrrsfaiy
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >5xf83 (3:)
    mdykdhdgdykdhdidykddddkggrmegstgfdgdattffapdavfgdrvrrfqefldt
    ftsyrdsvrsiqvynsnnaanynddqddaderdllgdddgddlekekkaasstslnilph
    riiislddlrefdrsfwsgilvepayfippaekaltdladsmddvphpnasavssrhpwk
    lsfkgsfgahalsprtltaqhlnklvsvegivtktslvrpklirsvhyaaktgrfhyrdy
    tdatttlttriptpaiyptedtegnkltteygystfidhqritvqempemapagqlprsi
    dvildddlvdktkpgdrvnvvgvfkslgaggmnqsnsntligfktlilgntvyplharst
    gvaarqmltdfdirninklskkkdifdilsqslapsiyghdhikkaillmlmggveknle
    ngshlrgdinilmvgdpstaksqllrfvlntaslaiattgrgssgvgltaavttdretge
    rrleagamvladrgvvcidefdkmtdvdrvaihevmeqqtvtiakagihttlnarcsvia
    aanpvfgqydvnrdphqnialpdsllsrfdllfvvtddineirdrsisehvlrthrylpp
    gylegepvrerlnlslavgedadinpeehsnsgagvenegeddedhvfekfnpllqagak
    laknkgnyngteipklvtipflrkyvqyakervipqltqeainvivknytdlrnddntkk
    spitartletlirlatahakvrlsktvnkvdakvaanllrfallgedigndideeeseye
    ealskrspqkspkkrqrvrqpasnsgspikstprrstassvnatpssarrilrfqddeqn
    ageddndimsplpadeeaelqrrlqlglrvsprrrehlhapeegssgpltevgtprlpnv
    ssagqddeqqqsvisfdnvepgtistgrlslisgiiarlmqteifeeesypvaslferin
    eelpeeekfsaqeylaglkimsdrnnlmvaddkvwrv
    

    Sequence, based on observed residues (ATOM records):
    >5xf83 (3:)
    tffapdavfgdrvrrfqefldtftsyrdsvrsiqvynsnnaanynddqdilphriiisld
    dlrefdrsfwsgilvepayfippaekaltdladsmddvphhpwklsfkgsfgahalsprt
    ltaqhlnklvsvegivtktslvrpklirsvhyaaktgrfhyrdytdatttlttriptpai
    yptedtegnkltteygystfidhqritvqempemapagqlprsidvildddlvdktkpgd
    rvnvvgvfkslgaggmnqsnligfktlilgntvyplharsarqmltdfdirninklskkk
    difdilsqslapsiyghdhikkaillmlmggveknlengshlrgdinilmvgdpstaksq
    llrfvlntaslaiattgrgssgvgltaavttdretgerrleagamvladrgvvcidefdk
    mtdvdrvaihevmeqqtvtiakagihttlnarcsviaaanpvfgqydvnrdphqnialpd
    sllsrfdllfvvtddineirdrsisehvlrthrvtipflrkyvqyakervipqltqeain
    vivknytdlrnddntkkspitartletlirlatahakvrlsktvnkvdakvaanllrfal
    l
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >5xf84 (4:)
    msqqsssptkednnssspvvpnpdsvppqlsspalfysssssqgdiygrnnsqnlsqgeg
    niraaigssplnfpsssqrqnsdvfqsqgrqgrirssasasgrsryhsdlrsdralptss
    sslgrngqnrvhmrrndihtsdlssprrivdfdtrsgvntldtssssappseaseplrii
    wgtnvsiqecttnfrnflmsfkykfrkildereefinnttdeelyyikqlnemrelgtsn
    lnldarnllaykqtedlyhqllnypqevisimdqtikdcmvslivdnnldydldeietkf
    ykvrpynvgsckgmrelnpndidklinlkglvlrstpvipdmkvaffkcnvcdhtmavei
    drgviqeparceridcnepnsmslihnrcsfadkqviklqetpdfvpdgqtphsislcvy
    delvdscragdrievtgtfrsipiransrqrvlkslyktyvdvvhvkkvsdkrldvdtst
    ieqelmqnkvdhneveevrqitdqdlakirevaaredlysllarsiapsiyeledvkkgi
    llqlfggtnktftkggryrgdinillcgdpstsksqilqyvhkitprgvytsgkgssavg
    ltayitrdvdtkqlvlesgalvlsdggvccidefdkmsdstrsvlhevmeqqtisiakag
    iittlnarssilasanpigsrynpnlpvtenidlpppllsrfdlvylvldkvdekndrel
    akhltnlyledkpehisqddvlpvefltmyisyakehihpiiteaaktelvrayvgmrkm
    gddsrsdekritattrqlesmirlaeahakmklknvveledvqeavrlirsaikdyatdp
    ktgkidmnlvqtgksviqrklqedlsreimnvlkdqasdsmsfnelikqinehsqdrves
    sdiqealsrlqqedkvivlgegvrrsvrlnnrv
    

    Sequence, based on observed residues (ATOM records):
    >5xf84 (4:)
    lriiwgtnvsiqecttnfrnflmsfkykfrkilderdeelyyikqlnemrelgtsnlnld
    arnllaykqtedlyhqllnypqevisimdqtikdcmvslivdnnldydldeietkfykvr
    pynvgsckgmrelnpndidklinlkglvlrstpvipdmkvaffkcnvcdhtmaveidrgv
    iqeparceridcnepnsmslihnrcsfadkqviklqetpdfvpdgqtphsislcvydelv
    dscragdrievtgtfrsipiransrqrvlkslyktyvdvvhvktstieqelmqnkvdhne
    veevrqitdqdlakirevaaredlysllarsiapsiyeledvkkgillqlfggtnktftk
    ggryrgdinillcgdpstsksqilqyvhkitprgvytsgkgssavgltayitrdvdtkql
    vlesgalvlsdggvccidefdkmsdstrsvlhevmeqqtisiakagiittlnarssilas
    anpigsrynpnlpvtenidlpppllsrfdlvylvldkvdekndrelakhltnlyledkpe
    hisqddvlpvefltmyisyakehihpiiteaaktelvrayvgmrkattrqlesmirlaea
    hakmklknvveledvqeavrlirsaikdyatmnlvqtgksviqrklqedlsreimnvlkd
    qasdsmsfnelikqinehsqdrvessdiqealsrlqqedkvivlgegvrrsvrlnn
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >5xf85 (5:)
    msfdrpeiysapvlqgespndddnteiiksfknfilefrldsqfiyrdqlrnnilvknys
    ltvnmehligynediykklsdepsdiiplfetaitqvakrisilsraqsannndkdpent
    smdtdslllnslptfqlilnsnanqiplrdldsehvskivrlsgiiistsvlssratyls
    imcrncrhttsitinnfnsitgntvslprsclstiesessmanesnigdestkkncgpdp
    yiiihesskfidqqflklqeipelvpvgemprnltmtcdryltnkvipgtrvtivgiysi
    ynskngagsgrsgggnggsgvairtpyikilgiqsdvetssiwnsvtmfteeeeeeflql
    srnpklyeiltnsiapsifgnedikkaivcllmggskkilpdgmrlrgdinvlllgdpgt
    aksqllkfvekvspiavytsgkgssaagltasvqrdpmtrefyleggamvladggvvcid
    efdkmrdedrvaiheameqqtisiakagittvlnsrtsvlaaanpiygryddlkspgdni
    dfqttilsrfdmifivkddhneerdisianhvinihtgnanamqnqqeengseisiekmk
    ryitycrlkcaprlspqaaeklssnfvtirkqllinelesterssipitirqleaiirit
    eslaklelspiaqerhvdeairlfqastmdaasqdpigglnqasgtslseirrfeqelkr
    rlpigwstsyqtlrrefvdthrfsqlaldkalyalekhetiqlrhqgqniyrsgv
    

    Sequence, based on observed residues (ATOM records):
    >5xf85 (5:)
    teiiksfknfilefrldsqfiyrdqlrnnilvknysltvnmehligynediykklsdeps
    diiplfetaitqvakrisilsraqsanslptfqlilnsnanqiplrdldsehvskivrls
    giiistsvlssratylsimcrncrhttsitinnfntgntvslprscncgpdpyiiihess
    kfidqqflklqeipelvpvgemprnltmtcdryltnkvipgtrvtivgiysiynskngsg
    vairtpyikilgiqsdvtmfteeeeeeflqlsrnpklyeiltnsiapsifgnedikkaiv
    cllmggskkilpdgmrlrgdinvlllgdpgtaksqllkfvekvspiavytsgkgssaagl
    tasvqrdpmtrefyleggamvladggvvcidefdkmrdedrvaiheameqqtisiakagi
    ttvlnsrtsvlaaanpiygryddlkspgdnidfqttilsrfdmifisiekmkryitycrl
    kcaprlspqaaeklssnfvtirkqllinelesterpitirqleaiiriteslaklelspi
    aqerhvdeairlfqastmdaastslseirrfeqelkrrlpigwstsyqtlrrefvdthrf
    sqlaldkalyalekhetiqlrhqgqniyrsgv
    

  • Chain '6':
    Sequence, based on SEQRES records:
    >5xf86 (6:)
    msspfpadtpssnrpsnsspppssigagfgsssgldsqigsrlhfpsssqphvsnsqtgp
    fvndstqfssqrlqtdgsatndmegneparsfksralnhvkkvddvtgekvreafeqfle
    dfsvqstdtgevekvyraqiefmkiydlntiyidyqhlsmrengalamaiseqyyrflpf
    lqkglrrvvrkyapellntsdslkrsegdegqadedeqqdddmngsslprdsgssaapgn
    gtsamatrsittstspeqtervfqisffnlptvhrirdirsekigsllsisgtvtrtsev
    rpelykasftcdmcraivdnveqsfkyteptfcpnpscenrafwtlnvtrsrfldwqkvr
    iqenaneiptgsmprtldvilrgdsverakpgdrckftgveivvpdvtqlglpgvkpsst
    ldtrgisktteglnsgvtglrslgvrdltykisflachvisigsnigasspdansnnret
    elqmaanlqannvyqdnerdqevflnslssdeinelkemvkdehiydklvrsiapavfgh
    eavkkgillqmlggvhkstvegiklrgdinicvvgdpstsksqflkyvvgfaprsvytsg
    kassaagltaavvrdeeggdytieagalmladngiccidefdkmdisdqvaiheameqqt
    isiakagihatlnartsilaaanpvggrynrklslrgnlnmtapimsrfdlffvilddcn
    ekidtelashivdlhmkrdeaieppfsaeqlrryikyartfkpiltkearsylvekykel
    rkddaqgfsrssyritvrqlesmirlseaiarancvdeitpsfiaeaydllrqsiirvdv
    ddvemdeefdniesqshaasgnnddnddgtgsgvitseppadieegqseatarpgtsekk
    kttvtydkyvsmmnmivrkiaevdregaeeltavdivdwyllqkendlgslaeyweerrl
    afkvikrlvkdrilmeihgtrhnlrdleneenennktvyvihpncevldqlepqdss
    

    Sequence, based on observed residues (ATOM records):
    >5xf86 (6:)
    vddvtgekvreafeqfledfsvqstdtgevekvyraqiefmkiydlntiyidyqhlsmre
    ngalamaiseqyyrflpflqkglrrvvrkyapervfqisffnlptvhrirdirsekigsl
    lsisgtvtrtsevrpelykasftcdmcraivdnveqsfkyteptfcpnpscenrafwtln
    vtrsrfldwqkvriqenaneiptgsmprtldvilrgdsverakpgdrckftgveivvpdt
    ykisflachvisigrdqevflnslssdeinelkemvkdehiydklvrsiapavfgheavk
    kgillqmlggvhktvegiklrgdinicvvgdpstsksqflkyvvgfaprsvytsgkassa
    agltaeagalmladngiccidefdkmdisdqvaiheameqqtisiakagihatlnartsi
    laaanpvggrynrklslrgnlnmtapimsrfdlffvilddcnekidtelashivdlhmkr
    deaieppfsaeqlrryikyartfkpiltkearsylvekykelrkddaqgsrssyritvrq
    lesmirlseaiarancvdeitpsfiaeaydllrqsiirvdvydkyvsmmnmivrkiaevd
    rtavdivdwyllqkendlgslaeyweerrlafkvikrlvkdrilmeihgtrh
    

  • Chain '7':
    Sequence, based on SEQRES records:
    >5xf87 (7:)
    msaalpsiqlpvdynnlfneitdflvtfkqdtlssdatrnenedenldaenieqhllekg
    pkymamlqkvanrelnsviidlddilqyqnekflqgtqaddlvsaiqqnanhftelfcra
    idnnmplptkeidykddvldvilnqrrlrnermlsdrtneirsenlmdttmdppssmnda
    lrevvedetelfppnltrryflyfkplsqncarryrkkaisskplsvrqikgdflgqlit
    vrgiitrvsdvkpaveviaytcdqcgyevfqevnsrtftplsectseecsqnqtkgqlfm
    straskfsafqeckiqelsqqvpvghiprslnihvngtlvrslspgdivdvtgiflpapy
    tgfkalkaglltetyleaqfvrqhkkkfasfsltsdveervmelitsgdvynrlaksiap
    eiygnldvkkalllllvggvdkrvgdgmkirgdinvclmgdpgvaksqllkaickisprg
    vyttgkgssgvgltaavmkdpvtdemileggalvladngiccidefdkmdesdrtaihev
    meqqtisiskaginttlnartsilaaanplygrynprlspldninlpaallsrfdilflm
    ldipsrdddeklaehvtyvhmhnkqpdldftpvepskmreyiayaktkrpvmseavndyv
    vqayirlrqdskremdskfsfgqatprtllgiirlsqalaklrladmvdiddveealrlv
    rvskeslyqetnkskedespttkiftiikkmlqetgkntlsyenivktvrlrgftmlqls
    nciqeysylnvwhlinegntlkfvddgtmdtdqedslvstpklapqttasanvsaqdsdi
    dlqda
    

    Sequence, based on observed residues (ATOM records):
    >5xf87 (7:)
    msaalpsiqlpvdynnlfneitdflvtfkqdkgpkymamlqkvanrelnsviidlddilq
    yqnekflqgtqaddlvsaiqqnanhftelfcraidnnmppnltrryflyfkplsqncarr
    yrisskplsvrqikgdflgqlitvrgiitrvsdvkpaveviaytcdqcgyevfqevnsrt
    ftplsectseecsqnqtkgqlfmstraskfsafqeckiqelsqqvpvghiprslnihvng
    tlvrslspgdivdvtgiflpapytgfkalkaglltetyleaqfvrqtsdveervmelits
    gdvynrlaksiapeiygnldvkkalllllvggvdkrvgdgmkirgdinvclmgdpgvaks
    qllkaickisprgvyttgkgssgvgltaavmkdpvtdemileggalvladngiccidefd
    kmdesdrtaihevmeqqtisiskaginttlnartsilaaanplygrynprlspldninlp
    aallsrfdilflmldipsrdddeklaehvtyvhmhnkqpdldftpvepskmreyiayakt
    krpvmseavndyvvqayirlrqdskremdskfsfgqatprtllgiirlsqalaklrladm
    vdiddveealrlvrvskeslyq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5xf8C (C:)
    msgtansrrkevlrvpvidlnrvsdeeqllpvvraillqhdtfllknyankavldallag
    lttkdlpdtsqgfdanftgtlpleddvwleqyifdtdpqlrfdrkcrneslcsiysrlfk
    lglffaqlcvksvvssaelqdcistshyatkltryfndngsthdgadagatvlptgddfq
    ylferdyvtflptgvltifpcakairykpstmattdnswvsidepdcllfhtgtllarws
    qgmhttsplqidpranivsltiwpplttpisskgegtianhlleqqikafpkvaqqyypr
    elsilrlqdamkfvkelftvcetvlslnalsrstgvppelhvllpqissmmkrkivqddi
    lklltiwsdayvvelnsrgeltmnlpkrdnlttltnksrtlafveraeswyqqviaskde
    imtdvpafkinkrrsssnsktvlsskvqtkssnanalnnsrylanskenfmykekmpdsq
    anlmdrlrererrsaallsqrqkryqqflamkmtqvfdilfsltrgqpytetylsslivd
    slqdsnnpigtkeaseilaglqgilpmdisvhqvdgglkvyrwnsldknrfskllqihks
    kqqd
    

    Sequence, based on observed residues (ATOM records):
    >5xf8C (C:)
    lrvpvidlnrvsdeeqllpvvraillqhdtfllknyankavldallaglttkdlpdtsqg
    fdanfvwleqyifdtdpqlrfdrkcrneslcsiysrlfklglffaqlcvksvvssaelqd
    cistshyatkltryfnerdyvtflptgvltifpcakairykpstmattdnswvsidepdc
    llfhtgtllarwsqgmhttsplqidpranivsltiwpplttpisskgegtianhlleqqi
    kafpkvaqqyyprsilrlqdamkfvkelftvcetvlslnalsrstgvppelhvllpqiss
    mmkrkivqddilklltiwsdayvvelnsrgeltmnlpkrdnlttltnksrtlafveraes
    wyqqviassqrqkryqqflamkmtqvfdilfsltrgqpytetylsslivdslqdstkeas
    eilaglqgilpmdisvhqvdgglkvyrwnsldknrfskllqihkskqqd