PDB entry 5xeu

View 5xeu on RCSB PDB site
Description: crystal structure of Hcp2 from Salmonella typhimurium
Class: cytosolic protein
Keywords: hexameric, CYTOSOLIC PROTEIN
Deposited on 2017-04-06, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciM, BKC11_01435, BLM41_12410, DD95_17705, SEETMRM10961_1365
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xeua_
  • Chain 'B':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciM, BKC11_01435, BLM41_12410, DD95_17705, SEETMRM10961_1365
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xeub_
  • Chain 'C':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciM, BKC11_01435, BLM41_12410, DD95_17705, SEETMRM10961_1365
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xeuc_
  • Chain 'D':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciM, BKC11_01435, BLM41_12410, DD95_17705, SEETMRM10961_1365
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xeud_
  • Chain 'E':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciM, BKC11_01435, BLM41_12410, DD95_17705, SEETMRM10961_1365
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xeue_
  • Chain 'F':
    Compound: Hcp1 family type VI secretion system effector
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: sciM, BKC11_01435, BLM41_12410, DD95_17705, SEETMRM10961_1365
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xeuf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xeuA (A:)
    msydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfeh
    yidraspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeia
    sresielsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeuA (A:)
    ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
    hipqailvmrkaleylkytftdliiamvspsgsqasresielsfstvkqeyvvqgtitag
    ydfkanke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xeuB (B:)
    msydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfeh
    yidraspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeia
    sresielsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeuB (B:)
    ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
    hipqailvmrkaeylkytftdliiamvspsgsqasresielsfstvkqeyvvqggtitag
    ydfkanke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xeuC (C:)
    msydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfeh
    yidraspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeia
    sresielsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeuC (C:)
    ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
    hipqailvmrkaleylkytftdliiamvspsgsqasresielsfstvkqeyvvqggtita
    gydfkanke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xeuD (D:)
    msydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfeh
    yidraspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeia
    sresielsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeuD (D:)
    ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
    hipqailvmrkaeylkytftdliiamvspsgsqasresielsfstvkqeyvvqnggtita
    gydfkanke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xeuE (E:)
    msydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfeh
    yidraspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeia
    sresielsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeuE (E:)
    ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
    hipqailvmrkaleylkytftdliiamvspsgsqasresielsfstvkqeyvvggtitag
    ydfkanke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xeuF (F:)
    msydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfeh
    yidraspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeia
    sresielsfstvkqeyvvqnqqggsggtitagydfkankei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeuF (F:)
    ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
    hipqailvmrkaleylkytftdliiamvspsgsqasresielsfstvkqeyvvggtitag
    ydfkanke