PDB entry 5xet

View 5xet on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis methionyl-tRNA synthetase bound by methionyl-adenylate (Met-AMP)
Class: ligase
Keywords: synthetase, aminoacyl-tRNA synthetase, complex, ATP, LIGASE
Deposited on 2017-04-06, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Methionine--tRNA ligase
    Species: Mycobacterium tuberculosis H37Ra [TaxId:419947]
    Gene: metG, MRA_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xetc1, d5xetc2
  • Heterogens: ME8, EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xetC (C:)
    mghhhhhhmkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehg
    lkvaqaaaaagvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsa
    agdiyldnysgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdk
    llahyhanpdfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdal
    tnyltgagfpdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgf
    lhnrgekmsksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdla
    nelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlale
    aiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesag
    kildllgqapnqrsfaavgvrltpgtalppptgvfpryqppqppegkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xetC (C:)
    kpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehglkvaqaaaa
    agvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldny
    sgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhanp
    dfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgagf
    pdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrkmsks
    vgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdlanelgnlaqrsl
    smvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlaleaiwlmlgdank
    yfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesagkildllgqapn
    qrsfaavgvrltpgtalppptgvfp