PDB entry 5xeo

View 5xeo on RCSB PDB site
Description: Crystal structure of a hydrogen sulfide-producing enzyme (Fn1220) from Fusobacterium nucleatum
Class: transferase
Keywords: Pyridoxal 5'-phosphate dependent enzyme, L-Cysteine, Hydrogen sulfide, Lanthionine, beta-Replacement reaction, Periodontal disease, TRANSFERASE
Deposited on 2017-04-05, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase
    Species: Fusobacterium nucleatum subsp. nucleatum strain ATCC 25586 [TaxId:190304]
    Gene: FN1220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RE94 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d5xeoa1, d5xeoa2
  • Chain 'B':
    Compound: Cysteine synthase
    Species: Fusobacterium nucleatum subsp. nucleatum strain ATCC 25586 [TaxId:190304]
    Gene: FN1220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xeob_
  • Heterogens: PLP, ACT, CA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xeoA (A:)
    gplgslansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaeke
    glidkdtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdg
    slgmkaclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtg
    tggsfsgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsl
    addilvcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsg
    ekylsnicdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeoA (A:)
    gplgslansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaeke
    glidkdtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdg
    gmkaclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtg
    gsfsgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgslad
    dilvcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgek
    yl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xeoB (B:)
    gplgslansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaeke
    glidkdtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdg
    slgmkaclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtg
    tggsfsgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsl
    addilvcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsg
    ekylsnicdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xeoB (B:)
    lansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglidk
    dtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdgslgmk
    aclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggsf
    sgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdil
    vcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyl