PDB entry 5xen

View 5xen on RCSB PDB site
Description: Crystal structure of a hydrogen sulfide-producing enzyme (Fn1220) from Fusobacterium nucleatum in complex with L-serine-PLP Schiff base
Class: transferase
Keywords: Pyridoxal 5'-phosphate dependent enzyme, L-Cysteine, Hydrogen sulfide, Lanthionine, beta-Replacement reaction, Periodontal disease, TRANSFERASE
Deposited on 2017-04-05, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase
    Species: Fusobacterium nucleatum subsp. nucleatum strain ATCC 25586 [TaxId:190304]
    Gene: FN1220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RE94 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d5xena1, d5xena2
  • Chain 'B':
    Compound: Cysteine synthase
    Species: Fusobacterium nucleatum subsp. nucleatum strain ATCC 25586 [TaxId:190304]
    Gene: FN1220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xenb_
  • Heterogens: PLP, SER, ACT, CA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xenA (A:)
    gplgslansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaeke
    glidkdtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdg
    slgmkaclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtg
    tggsfsgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsl
    addilvcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsg
    ekylsnicdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xenA (A:)
    slansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglid
    kdtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdgslgm
    kaclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggs
    fsgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdi
    lvcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xenB (B:)
    gplgslansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaeke
    glidkdtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdg
    slgmkaclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtg
    tggsfsgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsl
    addilvcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsg
    ekylsnicdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xenB (B:)
    lansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglidk
    dtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdgslgmk
    aclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggsf
    sgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdil
    vcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyls
    n