PDB entry 5xeg

View 5xeg on RCSB PDB site
Description: The structure of OsALKBH1
Class: oxidoreductase
Keywords: OsALKBH1 Fe(II)- and-ketoglutarate-dependent dioxygenases, OXIDOREDUCTASE
Deposited on 2017-04-05, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, 2OG-Fe oxygenase family protein, putative, expressed
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: LOC_Os03g60190, OsJ_13105
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xega_
  • Heterogens: AKG, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xegA (A:)
    keaaplqylrpgmvllkkflkhddqvdiirrcqklgigsggfytpgyrdggklslqmmcl
    gknwdpnsrsygdtrpfdgaqppsipevfskivkdaiqasneflrqkarpandveelppl
    spdiclvnfytssgklglhqdkdetkpslhkglpvvsfslgdtaeflygdvndvdkaskv
    dlesgdvlifggksrlifhgvsrikpktapnwltdeaklrpgrlnltfrqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xegA (A:)
    qylrpgmvllkkflkhddqvdiirrcqklgigsggfytpgyrdggklslqmmclgknwdp
    sygdtrpfdgaqppsipevfskivkdaiqasneflrqkarndveelpplspdiclvnfyt
    ssgklglhqdkdetkpslhkglpvvsfslgdtaeflygdvndvdkaskvdlesgdvlifg
    gksrlifhgvsrikpktapnwltdeaklrpgrlnltfrq