PDB entry 5xdu

View 5xdu on RCSB PDB site
Description: Staphylococcus aureus FtsZ 12-316 complexed with TXA6101
Class: hydrolase/hydrolase inhibitor
Keywords: Cell division, GTPase, Inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-03-30, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus (strain MRSA252) [TaxId:282458]
    Gene: ftsZ, SAR1162
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GHP9 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5xdua1, d5xdua2, d5xdua3
  • Heterogens: GDP, CA, ZI6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xduA (A:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xduA (A:)
    hmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrgl
    gaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltv
    gvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnv
    lrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaisspl
    letsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvt
    viatgf