PDB entry 5xdl

View 5xdl on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 L858R in complex with CO-1686
Class: transferase
Keywords: EGFR, L858R, inhibitor, TRANSFERASE
Deposited on 2017-03-28, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • engineered mutation (166)
    Domains in SCOPe 2.07: d5xdla_
  • Heterogens: 8JC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xdlA (A:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xdlA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikeeatspkank
    eildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnw
    cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgraklpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpedmddvvdadeyli