PDB entry 5xd6

View 5xd6 on RCSB PDB site
Description: CARK1 phosphorylates ABA receptors
Class: transferase
Keywords: Transferase, Kinase, Phosphorylation, ABA signaling
Deposited on 2017-03-27, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase superfamily protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g17410, AXX17_At3g18370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LUT0 (4-304)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5xd6a1, d5xd6a2
  • Chain 'B':
    Compound: Protein kinase superfamily protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g17410, AXX17_At3g18370
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xd6b_
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xd6A (A:)
    hhhhqpisvaaipadelrditdnygsksligegsygrvfygilksgkaaaikkldsskqp
    dqeflaqvsmvsrlrqenvvallgycvdgplrvlayeyapngslhdilhgrkgvkgaqpg
    pvlswhqrvkiavgaargleylhekanphvihrdikssnvllfdddvakiadfdlsnqap
    dmaarlhstrvlgtfgyhapeyamtgtlstksdvysfgvvllelltgrkpvdhtlprgqq
    svvtwatpklsedkvkqcvdarlngeyppkavaklaavaalcvqyeadfrpnmsivvkal
    qplln
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xd6A (A:)
    hhhhqpisvaaipadelrditdnygsksligegsygrvfygilksgkaaaikkldsskqp
    dqeflaqvsmvsrlrqenvvallgycvdgplrvlayeyapngslhdilhgraqpgpvlsw
    hqrvkiavgaargleylhekanphvihrdikssnvllfdddvakiadfdlsnqgyhapey
    amtglstksdvysfgvvllelltgrkpvdhtlprgqqsvvtwatpklsedkvkqcvdarl
    ngeyppkavaklaavaalcvqyeadfrpnmsivvkalqplln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xd6B (B:)
    hhhhqpisvaaipadelrditdnygsksligegsygrvfygilksgkaaaikkldsskqp
    dqeflaqvsmvsrlrqenvvallgycvdgplrvlayeyapngslhdilhgrkgvkgaqpg
    pvlswhqrvkiavgaargleylhekanphvihrdikssnvllfdddvakiadfdlsnqap
    dmaarlhstrvlgtfgyhapeyamtgtlstksdvysfgvvllelltgrkpvdhtlprgqq
    svvtwatpklsedkvkqcvdarlngeyppkavaklaavaalcvqyeadfrpnmsivvkal
    qplln
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xd6B (B:)
    qpisvaaipadelrditdnygsksligegsygrvfygilksgkaaaikkldsskqpdqef
    laqvsmvsrlrqenvvallgycvdgplrvlayeyapngslhdilhgrkgvkgaqpgpvls
    whqrvkiavgaargleylhekanphvihrdikssnvllfdddvakiadfdlsgyhapeya
    mtgtlstksdvysfgvvllelltgrkpvdhtlprgqqsvvtwatpklsedkvkqcvdarl
    ngeyppkavaklaavaalcvqyeadfrpnmsivvkalqplln