PDB entry 5xcn

View 5xcn on RCSB PDB site
Description: Crystal structure of M120A mutant of O-acetyl-L-serine sulfahydrylase from Haemophilus influenzae
Class: transferase
Keywords: Pyridoxal phosphate binding, cysteine synthase activity, L-cysteine desulfhydrase activity, transferase activity, serine acetyl transferase interacting protien, TRANSFERASE
Deposited on 2017-03-23, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Cysteine synthase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: cysK, HI_1103
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45040
      • engineered mutation (153)
    Domains in SCOPe 2.07: d5xcnx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5xcnX (X:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmaiyadnsysigntplvrlkhfghng
    nvvvkiegrnpsysvkcriganmvwqaekdgtltkgkeivdatsgntgialayvaaargy
    kitltmpetmslerkrllcglgvnlvltegakgakgaiakaeeivasdpsryvmlkqfen
    panpqihrettgpeiwkdtdgkvdvvvagvgtggsitgisraikldfgkqitsvavepve
    spvisqtlageevkpgphkiqgigagfipknldlsiidrvetvdsdtalatarrlmaeeg
    ilagissgaavaaadrlaklpefadklivvilpsaserylstalfegieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xcnX (X:)
    aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
    gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgak
    gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
    itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
    iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
    serylstalfegi