PDB entry 5xc1

View 5xc1 on RCSB PDB site
Description: Crystal structure of the complex of an aromatic mutant (W6A) of an alkali thermostable GH10 Xylanase from Bacillus sp. NG-27 with S-1,2-Propanediol
Class: hydrolase
Keywords: GH10 Xylanase, TIM barrel, HYDROLASE
Deposited on 2017-03-21, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-xylanase
    Species: Bacillus sp. NG-27 [TaxId:65673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30700 (1-354)
      • engineered mutation (6)
    Domains in SCOPe 2.07: d5xc1a_
  • Chain 'B':
    Compound: Beta-xylanase
    Species: Bacillus sp. NG-27 [TaxId:65673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30700 (1-354)
      • engineered mutation (6)
    Domains in SCOPe 2.07: d5xc1b_
  • Heterogens: MG, PGO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xc1A (A:)
    mvqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpe
    egvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqank
    elllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvaf
    etarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptid
    eirtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelye
    eldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xc1A (A:)
    vqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
    gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
    lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
    tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
    irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
    ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xc1B (B:)
    mvqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpe
    egvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqank
    elllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvaf
    etarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptid
    eirtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelye
    eldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xc1B (B:)
    vqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
    gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
    lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
    tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
    irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
    ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid