PDB entry 5xbx

View 5xbx on RCSB PDB site
Description: Crystal structure of GH45 endoglucanase EG27II in complex with cellobiose
Class: hydrolase
Keywords: Cellulase, Glycoside Hydrolase Family 45, HYDROLASE
Deposited on 2017-03-21, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-glucanase
    Species: Ampullaria crossean [TaxId:228791]
    Gene: EG27II
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7KMF0 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d5xbxa1, d5xbxa2
  • Heterogens: CBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xbxA (A:)
    slekraqlcqpdahgvrrfngrpcasttryvdghkgacgcgqkgsdtpfpwnlqkhvtap
    seryfddggsnlwcgkncgkcvrltptggfvpgkggappnhnpvvfmvtnacpingneew
    cgisgkpgtnhvnshgyevhfdlqdqvgqvealhwdnpevtweevpcpgdlqanyqqcec
    hnsdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xbxA (A:)
    raqlcqpdahgvrrfngrpcasttryvdghkgacgcgqkgsdtpfpwnlqkhvtapsery
    fddggsnlwcgkncgkcvrltptggfvpgkggappnhnpvvfmvtnacpingneewcgis
    gkpgtnhvnshgyevhfdlqdqvgqvealhwdnpevtweevpcpgdlqanyqqcechns