PDB entry 5xb0

View 5xb0 on RCSB PDB site
Description: 1.6 a crystal structure of peptidyl-prolyl cis-trans isomerase ppiase from pseudomonas syringae pv. tomato str. dc3000 (pspto dc3000)
Deposited on 2017-03-15, released 2017-04-19
The last revision was dated 2017-04-19, with a file datestamp of 2017-04-14.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: [Pseudomonas syringae] pv. tomato str. DC3000 [TaxId:223283]
    Gene: PSPTO_0135
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TLA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.01, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5xb0A (A:)
gtdapteaalkaertfmagekakpgvkeladgilmteltpgtgpkpdangrvevryvgrl
pdgkifdqstqpqwfrldsvisgwtsalqnmptgakwrlvipsdqaygaegagdlidpft
plvfeieliavsq