PDB entry 5x84

View 5x84 on RCSB PDB site
Description: Crystal Structure of Lanthanum ion (La3+) bound bovine alpha-lactalbumin
Class: metal binding protein
Keywords: Lanthanum, bovine alpha-lactalbumin, HAMLET, BAMLET, METAL BINDING PROTEIN
Deposited on 2017-02-28, released 2018-06-06
Made obsolete by 6ip9 on 2019-02-20

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Bos taurus [TaxId:9913]
    Gene: LALBA, ALACTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x84a_
  • Heterogens: SO4, GOL, LA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x84A (A:)
    eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
    ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
    ekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x84A (A:)
    eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
    ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
    ek