PDB entry 5x7y

View 5x7y on RCSB PDB site
Description: Crystal Structure of the Dog Lipocalin Allergen Can f 6
Class: allergen
Keywords: lipocalin allergen, allergen
Deposited on 2017-02-28, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipocalin-Can f 6 allergen
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: lcn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7ya_
  • Chain 'B':
    Compound: Lipocalin-Can f 6 allergen
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: lcn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7yb_
  • Chain 'C':
    Compound: Lipocalin-Can f 6 allergen
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: lcn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7yc_
  • Chain 'D':
    Compound: Lipocalin-Can f 6 allergen
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: lcn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7yd_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x7yA (A:)
    gsheeendvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnsslift
    mhtkvngkctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefq
    lmelygrkpdvspkvkekfvrycqgmeipkenildltqvdrclqarqseaaqvssae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7yA (A:)
    dvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnssliftmhtkvng
    kctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefqlmelygr
    kpdvspkvkekfvrycqgmeipkenildltqvdrclqar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x7yB (B:)
    gsheeendvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnsslift
    mhtkvngkctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefq
    lmelygrkpdvspkvkekfvrycqgmeipkenildltqvdrclqarqseaaqvssae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7yB (B:)
    dvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnssliftmhtkvng
    kctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefqlmelygr
    kpdvspkvkekfvrycqgmeipkenildltqvdrclqarqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5x7yC (C:)
    gsheeendvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnsslift
    mhtkvngkctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefq
    lmelygrkpdvspkvkekfvrycqgmeipkenildltqvdrclqarqseaaqvssae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7yC (C:)
    ndvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnssliftmhtkvn
    gkctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefqlmelyg
    rkpdvspkvkekfvrycqgmeipkenildltqvdrclqar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5x7yD (D:)
    gsheeendvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnsslift
    mhtkvngkctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefq
    lmelygrkpdvspkvkekfvrycqgmeipkenildltqvdrclqarqseaaqvssae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7yD (D:)
    dvvkgnfdiskisgdwysillasdikekieengsmrvfvkdievlsnssliftmhtkvng
    kctkislicnktekdgeydvvhdgynlfriietayedyiifhlnnvnqeqefqlmelygr
    kpdvspkvkekfvrycqgmeipkenildltqvdrclq