PDB entry 5x7v

View 5x7v on RCSB PDB site
Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum
Deposited on 2017-02-27, released 2017-03-15
The last revision was dated 2017-03-15, with a file datestamp of 2017-03-10.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.02, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5x7vA (A:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >5x7vA (A:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaapkwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5x7vB (B:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >5x7vB (B:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvikwkegkwsifewfttpdvgelirreiwhnplsyyl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5x7vC (C:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >5x7vC (C:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavipkwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5x7vD (D:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >5x7vD (D:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfvvec
    trikwkegknpiaavpkwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5x7vE (E:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >5x7vE (E:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtekvve
    ctrikwkegknpiaavpkwsifewfttpdvgelirreiwhnplsyyl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5x7vF (F:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >5x7vF (F:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnek
    vvectrikwkegknpiaavpkwsifewfpdvgelirreiwhnplsyyl