PDB entry 5x7l

View 5x7l on RCSB PDB site
Description: Structure of TsrD from Streptomyces laurentii
Class: isomerase
Keywords: Tsrd, TsrE, Streptomyces laurentii, ISOMERASE
Deposited on 2017-02-27, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TsrD
    Species: Streptomyces laurentii [TaxId:39478]
    Gene: tsrD
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0JRY3 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d5x7la1, d5x7la2
  • Chain 'B':
    Compound: TsrD
    Species: Streptomyces laurentii [TaxId:39478]
    Gene: tsrD
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0JRY3 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d5x7lb1, d5x7lb2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x7lA (A:)
    gpeldrasvqqlmehflaaynegdprhldhclhpeyrhpnpavergiegmraairrwast
    vedlsltlddlvvegdkavarmtfsgrqvgpilgipasgrrfsvglidifliedglfaqh
    wdemdllglhrqlgalpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7lA (A:)
    eldrasvqqlmehflaaynegdprhldhclhpeyrhpnpavergiegmraairrwastve
    dlsltlddlvvegdkavarmtfsgrqvgpilgipasgrrfsvglidifliedglfaqhwd
    emdllglhrqlgal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x7lB (B:)
    gpeldrasvqqlmehflaaynegdprhldhclhpeyrhpnpavergiegmraairrwast
    vedlsltlddlvvegdkavarmtfsgrqvgpilgipasgrrfsvglidifliedglfaqh
    wdemdllglhrqlgalpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7lB (B:)
    eldrasvqqlmehflaaynegdprhldhclhpeyrhpnpavergiegmraairrwastve
    dlsltlddlvvegdkavarmtfsgrqvgpilgipasgrrfsvglidifliedglfaqhwd
    emdllglhrqlgalp