PDB entry 5x7e

View 5x7e on RCSB PDB site
Description: Crystal structure of vitamin D hydroxylase cytochrome P450 105A1 (R84A mutant) in complex with 1,25-dihydroxyvitamin D2
Class: oxidoreductase
Keywords: metal-binding, monooxygenase, oxidoreductase
Deposited on 2017-02-25, released 2017-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 dihydroxylase
    Species: Streptomyces griseolus [TaxId:1909]
    Gene: cyp105A1, suaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18326 (Start-405)
      • engineered mutation (83)
      • variant (307)
      • expression tag (406)
    Domains in SCOPe 2.07: d5x7ea1, d5x7ea2
  • Heterogens: HEM, 7ZU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x7eA (A:)
    mtdtattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaa
    rkllgdprlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrik
    gmrpeveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrl
    vqstdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistaml
    lliaghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvat
    adievegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnl
    arlelevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7eA (A:)
    tattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkl
    lgdprlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmr
    peveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqs
    tdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllli
    aghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadi
    evegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarl
    elevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwh