PDB entry 5x6v

View 5x6v on RCSB PDB site
Description: Crystal structure of human heteroheptameric complex
Class: protein binding
Keywords: Ragulator Rag GTPase complex, scaffold, roadblock, lysosome, mTOR signaling, cell growth, PROTEIN BINDING
Deposited on 2017-02-23, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x6va_
  • Chain 'B':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x6vb_
  • Chain 'C':
    Compound: Ragulator complex protein LAMTOR5
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IAA8 (Start-122)
      • engineered mutation (59)
  • Chain 'F':
    Compound: Ras-related GTP-binding protein A
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAGA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Ras-related GTP-binding protein C
    Species: Mus musculus [TaxId:10090]
    Gene: RRAGC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x6vA (A:)
    mgssaddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalat
    dqgsklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeel
    rqvvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x6vA (A:)
    addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs
    klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvv
    e
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5x6vB (B:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    qvaas
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.