PDB entry 5x6u

View 5x6u on RCSB PDB site
Description: Crystal structure of human heteropentameric complex
Class: protein binding
Keywords: Ragulator complex, scaffold, roadblock, lysosome, mTOR signaling, cell growth, PROTEIN BINDING
Deposited on 2017-02-23, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ragulator complex protein LAMTOR3
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR3, MAP2K1IP1, MAPKSP1, PRO2783
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHA4 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d5x6ua1, d5x6ua2
  • Chain 'B':
    Compound: Ragulator complex protein LAMTOR2
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR2, MAPBPIP, ROBLD3, HSPC003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x6ub_
  • Chain 'C':
    Compound: Ragulator complex protein LAMTOR5
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR5, HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ragulator complex protein LAMTOR4
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR4, C7orf59
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ragulator complex protein LAMTOR1
    Species: Homo sapiens [TaxId:9606]
    Gene: LAMTOR1, C11orf59, PDRO, PP7157
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IAA8
      • engineered mutation (59)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x6uA (A:)
    mgssaddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalat
    dqgsklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeel
    rqvvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x6uA (A:)
    ssaddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdq
    gsklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrq
    vvev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x6uB (B:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    qvaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x6uB (B:)
    pkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngedn
    lkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqvaas
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.