PDB entry 5x5w

View 5x5w on RCSB PDB site
Description: Crystal structure of pseudorabies virus glycoprotein D
Class: viral protein/cell adhesion
Keywords: herpes simplex virus, pseudorabies virus, glycoprotein D, VIRAL PROTEIN-CELL ADHESION complex
Deposited on 2017-02-17, released 2017-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gd
    Species: Suid herpesvirus 1 [TaxId:10345]
    Gene: US6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nectin-1
    Species: Sus scrofa [TaxId:9823]
    Gene: NECTIN1, HVEC, PRR1, PVRL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5x5wb_
  • Chain 'C':
    Compound: gd
    Species: Suid herpesvirus 1 [TaxId:10345]
    Gene: US6
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nectin-1
    Species: Sus scrofa [TaxId:9823]
    Gene: NECTIN1, HVEC, PRR1, PVRL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5x5wd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5x5wB (B:)
    dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer
    veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5x5wD (D:)
    dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer
    veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvm