PDB entry 5x5h

View 5x5h on RCSB PDB site
Description: Crystal strcuture of metB from Corynebacterium glutamicum
Class: transferase
Keywords: PLP-binding domain, TRANSFERASE
Deposited on 2017-02-16, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine beta-lyases/cystathionine gamma-synthases
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: Cgl2446
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79VD9 (Start-385)
      • expression tag (386)
    Domains in SCOPe 2.07: d5x5ha1, d5x5ha2
  • Heterogens: PLP, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x5hA (A:)
    msfdpntqgfstasihagyepddyygsintpiyasttfaqnapnelrkgyeytrvgnpti
    valeqtvaalegakygrafssgmaatdilfriilkpgdhivlgndayggtyrlidtvfta
    wgveytvvdtsvveevkaaikdntkliwvetptnpalgitdieavakltegtnaklvvdn
    tfaspylqqplklgahavlhsttkyigghsdvvgglvvtndqemdeellfmqggigpips
    vfdayltarglktlavrmdrhcdnaekiaefldsrpevstvlypglknhpghevaakqmk
    rfggmisvrfaggeeaakkfctstkliclaeslggvesllehpatmthqsaagsqlevpr
    dlvrisigiediedlladveqalnnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x5hA (A:)
    fdpntqgfstasihagyepddyygsintpiyasttfaqnapnelrkgyeytrvgnptiva
    leqtvaalegakygrafssgmaatdilfriilkpgdhivlgndayggtyrlidtvftawg
    veytvvdtsvveevkaaikdntkliwvetptnpalgitdieavakltegtnaklvvdntf
    aspylqqplklgahavlhsttkyigghsdvvgglvvtndqemdeellfmqggigpipsvf
    dayltarglktlavrmdrhcdnaekiaefldsrpevstvlypglknhpghevaakqmkrf
    ggmisvrfaggeeaakkfctstkliclaeslggvesllehpatmthqsaagsqlevprdl
    vrisigiediedlladveqalnnlh